프리무라샵,이미테이션,짝퉁,홍콩명품쇼핑몰,미러급,레플리카사이트,샤넬,루이비통,구찌,프라다,지방시,셀린느,고야드,버버리,디올,ysl,생로랑,멀버리,몽끌레어,로렉스,까르띠에,가방,지갑,구두,스니커즈,클러치백,귀걸이,시계

3.25 Rating by CuteStat

vipmura.com is 3 years 11 months old. It is a domain having com extension. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. As no active threats were reported recently by users, vipmura.com is SAFE to browse.

PageSpeed Score
30
Siteadvisor Rating
Not Applicable

Traffic Report

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: 5

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: Not Applicable
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

104.28.23.33

Hosted Country:

United States of America US

Location Latitude:

37.751

Location Longitude:

-97.822
프리무라샵,이미테이션,짝퉁,홍콩명품쇼핑몰,미러급,레플리카사이트,샤넬,루이비통,구찌,프라다,지방시,셀린느,고야드,버버리,디올,ysl,생로랑,멀버리,몽끌레어,로렉스,까르띠에,가방,지갑,구두,스니커즈,클러치백,귀걸이,시계

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 9 H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: Not Applicable
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: 1 Total Images: 100
Google Adsense: Not Applicable Google Analytics: UA-84642752-1

Websites Hosted on Same IP (i.e. 104.28.23.33)

Paul Irish

- paulirish.com
310,632 $ 28,620.00


سهامداران پدیده شاندیز و پدیده کیش

- shandizstocks.ir

سایت سهامداران پدیده شاندیز و پدیده کیش به همراه آخرین اخبار درباره پروژه های شرکت پدیده شاندیز محلی مناسب برای تمام افرای که سهام پدیده شاندیز را دارند

30,640 $ 271,440.00

uevf.org: SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Paras

- uevf.org

Get the Latest News, updates, publications and the newest posts from sources uevf.org. SAG Awards 2020 Film Nominations: From 'Bombshell' to 'Parasite,' These Are the Ones to Beat

Not Applicable $ 8.95

Traffic Ticket Attorneys | York & Lancaster, PA | 717 889 7100

- centralpennsylvaniatrafficlawyers.com

Fight That Traffic Ticket! Whether it is a Speeding Ticket or another violation our experienced traffic lawyers will protect your right to drive and right to work

Not Applicable $ 8.95

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Sun, 10 May 2020 23:22:13 GMT
Content-Type: text/html; charset=utf-8
Transfer-Encoding: chunked
Connection: keep-alive
X-Powered-By: PHP/7.0.29
P3P: CP="ALL CURa ADMa DEVa TAIa OUR BUS IND PHY ONL UNI PUR FIN COM NAV INT DEM CNT STA POL HEA PRE LOC OTC"
Expires: 0
Last-Modified: Sun, 10 May 2020 23:22:13 GMT
Cache-Control: pre-check=0, post-check=0, max-age=0
Pragma: no-cache
CF-Cache-Status: DYNAMIC
Server: cloudflare
CF-RAY: 591766a9c925023f-SJC
Content-Encoding: gzip
cf-request-id: 02a27e7e200000023f3436f200000001

Domain Information

Domain Registrar: Megazone Corp., dba HOSTING.KR
Registration Date: May 9, 2020, 5:45 PM 3 years 11 months 3 weeks ago
Expiration Date: May 9, 2021, 5:45 PM 2 years 11 months 3 weeks ago
Domain Status:
ok

Domain Nameserver Information

Host IP Address Country
arya.ns.cloudflare.com 108.162.192.70 United States of America United States of America
alec.ns.cloudflare.com 172.64.33.59 United States of America United States of America

DNS Record Analysis

Host Type TTL Extra
vipmura.com A 300 IP: 104.28.23.33
vipmura.com A 300 IP: 104.28.22.33
vipmura.com NS 86400 Target: alec.ns.cloudflare.com
vipmura.com NS 86400 Target: arya.ns.cloudflare.com
vipmura.com SOA 3600 MNAME: alec.ns.cloudflare.com
RNAME: dns.cloudflare.com
Serial: 2034066555
Refresh: 10000
Retry: 2400
Expire: 604800
Minimum TTL: 3600
vipmura.com AAAA 300 IPV6: 2606:4700:3031::681c:1621
vipmura.com AAAA 300 IPV6: 2606:4700:3035::681c:1721

Full WHOIS Lookup

Domain Name: vipmura.com
Registry Domain ID: 2523874065_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.hosting.kr
Registrar URL: http://www.hosting.kr
Updated Date: 2020-05-09T12:00:00Z
Creation Date: 2020-05-09T12:00:00Z
Registrar Registration Expiration Date: 2021-05-09T12:00:00Z
Registrar: Megazone Corp., dba HOSTING.KR
Registrar IANA ID: 1489
Registrar Abuse Contact Email: help@hosting.kr
Registrar Abuse Contact Phone: +82.16447378
Reseller:
Domain Status: ok https://icann.org/epp#ok
Registry Registrant ID: Not Available From Registry
Registrant Name: kimjw
Registrant Organization: kimjw
Registrant Street: mafan Eojin-gil, Wansan-gu, Jeonju-si
Registrant City: Jeollabuk-do
Registrant State/Province:
Registrant Postal Code: 55041
Registrant Country: KR
Registrant Phone: +82.26545453
Registrant Phone Ext:
Registrant Fax:
Registrant Fax Ext:
Registrant Email: daftpunkhelp@gmail.com
Registry Admin ID: Not Available From Registry
Admin Name: kimjw
Admin Organization: kimjw
Admin Street: mafan Eojin-gil, Wansan-gu, Jeonju-si
Admin City: Jeollabuk-do
Admin State/Province:
Admin Postal Code: 55041
Admin Country: KR
Admin Phone: +82.26545453
Admin Phone Ext:
Admin Fax:
Admin Fax Ext:
Admin Email: daftpunkhelp@gmail.com
Registry Tech ID: Not Available From Registry
Tech Name: kimjw
Tech Organization: kimjw
Tech Street: mafan Eojin-gil, Wansan-gu, Jeonju-si
Tech City: Jeollabuk-do
Tech State/Province:
Tech Postal Code: 55041
Tech Country: KR
Tech Phone: +82.26545453
Tech Phone Ext:
Tech Fax:
Tech Fax Ext:
Tech Email: daftpunkhelp@gmail.com
Name Server: alec.ns.cloudflare.com
Name Server: arya.ns.cloudflare.com
Name Server:
Name Server:
Name Server:
DNSSEC: unsigned
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2020-05-09T12:00:00Z <<<

For more information on Whois status codes, please visit https://icann.org/epp

Welcome to Megazone Corp. dba hosting.kr WHOIS data service.

The data contained in hosting.kr's WhoIs database.
Megazone Corp. does not guarantee accuracy for WHOIS.
This information is provided for the sole purpose of assisting you in
obtaining information about domain name registration records.

Megazone Corp. is Domain & Hosting provider, very huge web agency Company,
No. 1 in Korea and operating "Online Marketing & Promotion", "3D & Motion",
"eCommerce" and "Web Portal Service". We offer all service regarding
Information Technical and we have many experience for domain & hosting and
web agency solution. If you want to find partner of IT industry,
contact Megazone Corp. dba hosting.kr.

We are creating high value service and low in price for domain
& hosting providing. Obtain good service for domain name registration,
transfer or renewal with any hosting package with <a href="http://www.hosting.kr">http://www.hosting.kr</a>

Thank you for finding domain name of hosting.kr